PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009376P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 129aa    MW: 15459.9 Da    PI: 11.2995
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009376P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.14.1e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W + Ed +l   v+++G + W++Ia+  g+ R++k+c+ rw++yl
   MELO3C009376P1 14 RGPWLEAEDRQLTIFVTRMGERKWDLIAKASGLERSGKSCRFRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding49.87.8e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      r+r   eE+e++++++k++G++ W++Ia+ ++ gRt++++k++w+++l
   MELO3C009376P1  67 RDRINSEEEEIILKLHKKWGNK-WSRIAQWLP-GRTDNEIKNYWRSHL 112
                      567789****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.155961IPR017930Myb domain
SuperFamilySSF466898.98E-2611108IPR009057Homeodomain-like
SMARTSM007177.1E-101363IPR001005SANT/Myb domain
PfamPF002495.6E-111461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-191568IPR009057Homeodomain-like
CDDcd001675.53E-61661No hitNo description
PROSITE profilePS5129423.13962116IPR017930Myb domain
SMARTSM007171.6E-1266114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2269115IPR009057Homeodomain-like
PfamPF002492.0E-1372112IPR001005SANT/Myb domain
CDDcd001676.17E-973112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MANQSALQTE RLRRGPWLEA EDRQLTIFVT RMGERKWDLI AKASGLERSG KSCRFRWLNY  60
LRPNLKRDRI NSEEEEIILK LHKKWGNKWS RIAQWLPGRT DNEIKNYWRS HLRKKFPIQL  120
EGSRKTLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-26121162105C-Myb DNA-Binding Domain
1msf_C1e-26121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818411e-68LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132581e-68LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008442723.13e-84PREDICTED: transcription factor MYB114-like
SwissprotQ4JL765e-48MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLA0A097HUK13e-55A0A097HUK1_JATCU; MYB family protein
STRINGVIT_08s0007g04830.t016e-53(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131692631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.32e-44myb domain protein 59